Player Search Logo

Keenan Allen

#1 WR,

Bears

Photo of Keenan Allen for fantasy football

ACTUAL 2022

164 FPTS

RANK: 42

2023 SEASON

232 FPTS

RANK: 14

AGE

31 yrs

HEIGHT/WEIGHT

6'2'' / 211 lbs

COLLEGE

California

SEASONGPFPTSRANKTARGETRECPTREYDRETDREAVE
20231523214th134931037611.2
20221016442nd8966752411.4
3yr Ave152567th1511031110710.78

Three catches in Week 18 win

RotoWire Logo Published: 2025-01-05

Allen brought in all three targets for 25 yards in the Bears' 24-22 win over the Packers on Sunday. He also threw incomplete on one pass attempt.

The veteran wideout nearly threw an interception on a trick play and finished a distant second in receiving yards for the Bears on the afternoon. Allen followed up a highly productive two-game stretch in Week 15-16 (15-223-2) with a modest eight receptions for 50 yards over the last pair of contests of his first Bears season, but he figures to once again serve as a critical target for Caleb Williams under a new offensive system in 2025.

Fantasy Points by Week 2022

10.6
3.1
12.4
15.9
20.8
21.2
16.6
21.4
11.8
30.2

Weekly Stats 2022

Fantasy PointsBettingReceiving StatsRoutes Run
WEEKSTADIUMGAMERANKTARGETSPREADO/UTRGTRECYDTDAVGAIRYACDROP10+20+50+SHARESLOTTIGHTWIDE
1 LV Outdoor 85° 10.6 43rd 2.65-3.552.54466016.51340%21012%41%0%59%
7 SEA Outdoor 73° 3.1 75th 1.55-5.051.5221105.5330%1004%61%0%39%
11 KC Outdoor 69° 12.4 29th 2.485.050.58594018.81360%41028%59%0%41%
12 @ARZ Dome 64° 15.9 22nd 3.18-3.047.5754919.8450%30015%64%0%36%
13 @LV Dome 73° 20.8 12th 3.473.049.514688114.71410%41031%68%0%32%
14 MIA Outdoor 57° 21.2 10th 1.773.552.514129207.7350%40029%57%0%44%
15 TEN Outdoor 66° 16.6 19th 2.08-3.045.59886010.8740%31024%64%0%37%
16 @IND Dome 22° 21.4 9th 1.95-3.546.5141110409.57315%41047%49%0%49%
17 LA Outdoor 62° 11.8 25th 1.97-6.540.56560012.0840%21019%52%0%46%
18 @DEN Outdoor 43° 30.2 1st 3.786.540.5118102212.8760%61025%63%0%37%

Performance Splits: 2020 to 2022

Fantasy PointsReceiving Averages
LOCATIONSTADIUMGPGSGMTOUCHRANKTRGTRECYDTDAVEAIRYACDROP10+20+50+
Home Outdoor 21 200.81.6753rd10.47.4830.311.27.44.14%3.31.10.0
Away Outdoor 12 121.51.7336th10.06.8640.79.45.83.84%2.90.30.0
Away Dome 4 42.91.69100th6.83.8470.512.410.71.76%2.50.30.0
Away Retractable Dome 3 35.01.6646th9.06.7630.39.45.93.69%2.70.30.0

Career Stats by Season: 2013 to 2022

Fantasy PointsReceiving StatsRoutes Run
SEASONAGETEAMGPGSTOTALRANKTRGTRECYDTDAVGAIRYACDROP10+20+50+SHARESLOTTIGHTWIDE
2013 21 undefined 15 14 220 19th104711,046814.7967%5216019%9%0%90%
2014 22 undefined 14 14 175 37th12177783410.2645%356021%10%1%87%
2015 23 undefined 8 8 162 42nd8967725410.8747%278014%15%0%84%
2016 24 undefined 1 1 12 164th7663010.5830%3001%19%0%82%
2017 25 LAC 16 15 284 3rd1591021,393613.7957%6618228%43%1%55%
2018 26 LAC 16 14 260 12th136971,196612.3844%5813127%47%1%51%
2019 27 LAC 16 16 262 6th1491041,199611.5846%5315026%48%2%50%
2020 28 LAC 14 13 245 26th14710099289.9643%4310024%52%1%48%
2021 29 LAC 16 16 258 11th1571061,138610.7837%4712024%57%0%42%
2022 30 LAC 10 10 164 42nd8966752411.4743%337013%59%0%41%
Yards ball travels in the "Air" per completion. "YAC" is average yards gained after catch. "Drop"ped pass rate. "Share" of team passing targets.

Does little with five grabs

RotoWire Logo Published: 2024-12-26

Allen brought in five of eight targets for 25 yards in the Bears' 6-3 loss to the Seahawks on Thursday night.

Coming off a spectacular nine-catch, 141-yard, one-touchdown showing against the Lions in Week 16, Allen, and the Bears' offense as a whole for that matter, experienced a major downturn in the disappointing defeat. The veteran receiver did tie DJ Moore for the team lead in targets while finishing second to his teammate in receptions. Allen has at least five catches in three consecutive contests heading into the Week 18 regular-season finale at Lambeau Field against the Packers on Sunday, Jan. 5.

Another impressive effort in loss

RotoWire Logo Published: 2024-12-22

Allen secured nine of 13 targets for 141 yards and a touchdown in the Bears' 34-17 loss to the Lions on Sunday.

Allen led the Bears across the board in receptions, receiving yards and targets while either tying (catches, targets) or setting (yardage) new season bests in each category. The veteran wideout also scored his fifth touchdown in the last five games on a perfectly timed throw-and-catch sequence between him and Caleb Williams that covered 45 yards late in the second quarter. Allen now has at least five receptions and 73 receiving yards in four of the last five games, his most productive stretch of the season as a Week 17 home matchup against the Seahawks awaits Thursday night.

Vintage performance Monday

RotoWire Logo Published: 2024-12-16

Allen had six receptions (on 13 targets) for 82 yards and a touchdown in Monday's 30-12 loss to Minnesota.

Allen bounced back from last week's dud against the 49ers (3-30-0) with a performance against the Vikings that was reminiscent of his dominant days with the Chargers. After a terribly slow start to the season, the veteran wideout has posted a 23-271-4 receiving line over his last four contests. Allen will attempt to keep his recent string of hot play going in Week 16 against the Lions on Sunday.

Held to 30 yards Sunday

RotoWire Logo Published: 2024-12-08

Allen (ankle) brought in three of five of targets for 30 receiving yards in Sunday's 38-13 loss to the 49ers.

Allen overcame a minor ankle injury during the practice week in order to suit up for Sunday's eventual loss. The seasoned veteran posted vanilla numbers on the heels of his two most-productive games. Allen has underwhelmed in Chicago outside of the two aforementioned performances, averaging just 3.7 receptions and 34.7 yards in nine other active games this season. Perhaps the 32-year-old has finally lost a step in his 12th year, or his down numbers could simply be the result of the Bears' overall ineptitude on offense. Whatever the case, Allen checks in as a middling fantasy option ahead of next Monday's road tilt against the Vikings.

Returns as full practice participant

RotoWire Logo Published: 2024-12-05

Allen (ankle) was a full practice participant Thursday.

Allen sat out Wednesday's practice due to the ankle issue, but his ability to take every rep a day later likely indicates that his absence to begin Week 14 prep was maintenance-related. Meanwhile, top wideout DJ Moore (quadricep) has sat out both of the Bears' practices this week, clouding his status for Sunday's game at San Francisco. If Moore's injury forces him to miss his first contest of the season, Allen would likely be in store for an expanded profile in Chicago's passing attack.

Doesn't practice Wednesday

RotoWire Logo Published: 2024-12-04

Allen didn't practice Wednesday due to an ankle injury.

Allen was among three key Bears skill-position players -- also, fellow WR DJ Moore (quadriceps) and RB D'Andre Swift (quadriceps) -- that didn't log any work to begin Week 14 prep. Allen rolled his ankle during a Nov. 22 practice, so his absence Wednesday may be maintenance related. Still, his status will be monitored as the week goes on to determine whether his availability for Sunday's game at San Francisco may be in question.

Two Thanksgiving touchdowns

RotoWire Logo Published: 2024-11-28

Allen caught five passes for 73 yards and two touchdowns on eight targets against Detroit on Thursday.

Allen's eight targets were just over half as much target volume as he commanded in Week 12, but the per-target returns were more efficient for Allen against the Lions. The Chicago passing game did next to nothing in the first half, but Allen was very productive in the second half, scoring both of his touchdowns. The Bears offense is still clunky at best, but Allen's fantasy prospects have taken a turn for the better by drawing 23 targets over the last two weeks. He'll try to keep rolling at San Francisco in Week 14.

Commands 15 targets

RotoWire Logo Published: 2024-11-24

Allen recorded nine receptions on 15 targets for 86 yards and a touchdown in Sunday's 30-27 overtime loss to the Vikings.

Allen earned a season-best 15 targets, his third-double digit target total of the campaign. Though he wasn't particularly efficient, he managed to top 45 receiving yards for the first time as a Bear, highlighted by a 40-yard catch and run midway through the first quarter. Allen also tallied his third touchdown of the season with 22 seconds remaining in the game to help set up a remarkable comeback that ultimately fell just short. While it was a positive performance, Allen's track record in Chicago suggests he may not replicate it any time soon.

>>> View all Keenan Allen news