Player Search Logo

Russell Wilson

#1 QB,

Steelers

Photo of Russell Wilson for fantasy football

ACTUAL 2022

226 FPTS

RANK: 16

2023 SEASON

325 FPTS

RANK: 13

AGE

34 yrs

HEIGHT/WEIGHT

5'11'' / 215 lbs

COLLEGE

Wisconsin

SEASONGPFPTSRANKPAATTPACMPPAYDPATDPAINTCOMP%RUATTRUYDRUTD
20231632513th5443553878251165.3592583
20221522616th4832923,524161160.5552773
3yr Ave153178th491328381232867%673462

Late comeback attempt not enough

RotoWire Logo Published: 2025-01-11

Wilson completed 20 of 29 passes for 270 yards, two touchdowns and zero interceptions in Saturday's 28-14 loss to the Ravens. He added three rushes for six yards.

Wilson struggled to close the regular season and that carried over into the first half of Saturday's playoff matchup. Things turned around in the second half for him, however, as he aired the ball out with the Steelers down multiple scores and tallied six completions of more than 20 yards. That included a pair of long passing scores that went for 36 and 30 yards to George Pickens and Van Jefferson, respectively. Despite that fairly impressive close to the campaign, Wilson lost five straight games as the leader of the Steelers offense, and he totaled just seven touchdowns while averaging only 6.4 yards per attempt in that span. That sets him up for an intriguing offseason, as he enters free agency clearly on the back end of his career but still capable of orchestrating an effective offense at times.

Fantasy Points by Week 2022

17.8
11.1
9.1
27.5
9.2
13.8
13.8
14.2
10.7
8.5
9.7
25.6
8.3
23.6
23.1

Weekly Stats 2022

Fantasy PointsBettingPassing StatsRushing StatsAdvanced Passing StatsTargets
WEEKSTADIUMGAMERANKSPREADO/UATTCMPYDTDINTCOMP%RATINGATTYDTDAIRCATCH20YD+PLAYWRRBTE
1 @SEA Outdoor 73° 17.8 14th -6.043.542293401069.0101.3120474%33%29%36%43%19%
2 HOU Outdoor 79° 11.1 24th -10.545.531142191145.266.52301155%50%31%61%16%13%
3 SF Outdoor 72° 9.1 28th 1.544.533201840060.675.86170570%33%19%52%36%9%
4 @LV Dome 91° 27.5 3rd 3.045.525172372068.0124.942911084%40%13%68%20%8%
5 IND Outdoor 71° 9.2 27th -3.542.539212740253.854.94220562%25%28%56%18%23%
6 @LAC Outdoor 69° 13.8 15th 3.545.528151881053.686.64230854%60%17%54%21%14%
8 @JAC Dome 61° 13.8 21st 1.040.530182521160.084.34170763%33%5%50%20%17%
10 @TEN Outdoor 36° 14.2 22nd 2.539.542212861150.070.1780555%20%20%52%26%14%
11 LV Outdoor 49° 10.7 19th -3.041.531242470077.499.8180481%25%14%39%29%23%
12 @CAR Outdoor 66° 8.5 32nd -1.535.535191421054.373.8280563%14%15%74%9%9%
13 @BAL Outdoor 63° 9.7 27th 8.538.522171890077.3102.32210882%60%39%32%27%36%
14 KC Outdoor 55° 25.6 4th 9.043.536232473163.9100.14570372%0%20%39%28%31%
16 @LA Outdoor 83° 8.3 29th -3.535.527152141355.654.221701059%33%3%56%11%30%
17 @KC Outdoor 47° 23.6 5th 12.543.538262221168.481.34272376%100%39%42%29%24%
18 LAC Outdoor 43° 23.1 1st -6.540.524132833154.2118.681801554%57%27%67%17%8%

Performance Splits: 2020 to 2022

Fantasy PointsPassing AveragesRushing Averages
LOCATIONSTADIUMGPGSGMRANKYDTDINTCOMP%RATINGAIRCATCH20YD+YDTD
Home Outdoor 20 2019.610th2392.20.666.0104.473%41%6220.1
Away Outdoor 16 1614.226th2281.00.962.281.766%29%6200.3
Away Dome 2 222.111th2681.5070.2117.277%30%7180.5
Away Retractable Dome 7 723.79th2712.70.766.7110.970%42%7260.1

Career Stats by Season: 2012 to 2022

Fantasy PointsPassing StatsRushing StatsAdvanced Passing StatsTargets
SEASONAGETEAMGPGSTOTALRANKATTCMPYDTDINTCMP%RATINGATTYDTDAIRCATCH20YD+PLAYWRRBTE
2012 24 SEA 16 16 276 11th3932523,118261064.11009448947.570%41%-58%19%22%
2013 25 SEA 16 16 270 8th4072573,35726963.1101.29653917.566%42%-61%16%20%
2014 26 SEA 16 16 329 3rd4522853,47520763.19511884965.667%39%-60%16%19%
2015 27 SEA 16 16 336 3rd4833294,02434868.1110.110355316.773%43%-54%17%26%
2016 28 SEA 16 16 270 10th5463534,219211164.792.6722591769%47%-57%17%22%
2017 29 SEA 16 16 348 1st5533393,983341161.395.4955863767%36%-52%19%24%
2018 30 SEA 16 16 299 9th4272803,44835765.6110.96737607.470%42%-56%20%17%
2019 31 SEA 16 16 329 3rd5163414,11031566.1106.3753423769%41%23%59%17%20%
2020 32 SEA 16 16 360 6th5583844,212401368.8105.18351326.274%34%22%59%18%19%
2021 33 SEA 14 14 243 15th4002593,11325664.8103.14318326.769%38%24%62%14%21%
2022 34 DEN 15 15 226 16th4832923,524161160.584.45527736.267%36%21%51%24%18%
*"Air" yards thrown per completion. Pass was "Catch"able. Percent of passes thrown "20yds+" that were completed. "Play" action pass percent of total pass plays.

Slide continues against Bengals

RotoWire Logo Published: 2025-01-04

Wilson completed 17 of 31 passes for 148 yards, one touchdown and no interceptions in Saturday's 19-17 loss to the Bengals. He added four rushes for 16 yards.

Wilson and the Steelers failed to get anything going in the first half, as he completed just four of eight passes for 45 yards. A desperate comeback in the final 10 minutes of game time led to a slightly improved line, highlighted by several long completions to Pat Freiermuth -- including a 19-yard touchdown. While Wilson managed to salvage his stat line to some degree, he's failed to reach 220 passing yards in each of his last five games while throwing for just six total touchdowns in that span. He and the Steelers enter the postseason on a four-game skid and will square off against either the Texans or Ravens.

Held in check in Week 17

RotoWire Logo Published: 2024-12-25

Wilson completed 23 of 37 passes for 205 yards and an interception in a 29-10 loss to Kansas City on Christmas Day. He added 55 rushing yards and a touchdown on six carries.

The veteran quarterback's one pick was costly, as it came in the end zone late in the first quarter as the Steelers tried to drive for their first points of the day. Wilson did produce a one-yard TD run in the second quarter, but otherwise the Kansas City pass rush made his life miserable and sacked him five times. Wilson has failed to reach 220 passing yards in four straight games and has committed three turnovers against three TD passes in the last three contests, but even with the Ravens having won Wednesday, the Steelers will still have a chance to claim the AFC North title if they can beat the Bengals, and get some help, in Week 18.

Key mistakes in loss to Ravens

RotoWire Logo Published: 2024-12-21

Wilson completed 22 of 33 passes for 217 yards, two touchdowns and one interception in Saturday's 34-17 loss to the Ravens. He added three rushes for 27 yards while also losing a fumble.

Wilson's stat line was mediocre, particularly considering he remained without George Pickens (hamstring). He was able to get rid of the ball quickly on several occasions, allowing Jaylen Warren and others to pick up yards after the catch while also connecting on deep shots of 44 and 21 yards to Calvin Austin and Van Jefferson, respectively. However, two key mistakes overshadowed the positives, the first of which was when he lost a fumble deep in Baltimore territory after a 19-yard scramble early in the second quarter. Wilson then threw a pick-six early in the final quarter in what turned out to be the decisive sequence of the game. Wilson has now failed to throw for at least 225 yards in his last three matchups -- all of which have come without Pickens.

Struggles in Philly

RotoWire Logo Published: 2024-12-15

Wilson completed 14 of 22 passes for 128 yards, one touchdown and zero interceptions in Sunday's 27-13 loss to the Eagles. He added four rushes for 13 yards.

The Eagles dominated time of possession, and the Steelers ran only offensive 41 plays. In part, that was due to Wilson's inability to move the Pittsburgh offense, as the unit totaled -19 yards through their five possessions while picking up only 163 net yards for the game. The end result was Wilson's lowest yardage total as the team's starter and marks his second consecutive performance with less than 160 passing yards with George Pickens (hamstring) sidelined. Though Baltimore's passing defense has been leaky at times, it will be difficult to trust Wilson moving forward -- particularly so long as Pickens is out.

Two touchdowns in win

RotoWire Logo Published: 2024-12-08

Wilson completed 15 of 26 passes for 158 yards, two touchdowns and no interceptions in Sunday's 27-14 win over the Browns. He added six rushes for 17 yards.

Wilson started the game slowly as he had just 46 yards on 16 attempts at halftime. However, he led the Steelers on an eight-play, 67-yard touchdown drive that ended with a 10-yard pass to Van Jefferson on the team's first offensive possession. One drive later, he took advantage of a short field and delivered a 20-yard score to Pat Freiermuth. This wasn't Wilson's most prolific performance, but he managed the offense well and threw for multiple scores for the fourth time in seven starts on the campaign.

Lights up Bengals' secondary

RotoWire Logo Published: 2024-12-01

Wilson completed 29 of 38 passes for 414 yards, three touchdowns and one interception in Sunday's 44-38 win over the Bengals.

Wilson got off to a rough start, as his fourth pass attempt of the game was picked and returned for a score. However, he was nearly mistake-free from there, completing nine passes of 20 yards or more en route to averaging 10.9 yards per attempt. Wilson also threw for multiple scores for the first time since Week 10, which came from 17, 23 and 25 yards away. Despite the strong showing, Wilson remains a risky fantasy option reliant upon strong efficiency, as this marked just the second time in six starts that he's attempted 30 passes.

Impressive numbers in loss

RotoWire Logo Published: 2024-11-21

Wilson completed 21 of 28 passes for 270 yards with one touchdown and no interceptions and rushed three times for 10 yards in the Steelers' 24-19 loss to the Browns on Thursday night. He also lost a fumble and recovered another.

Wilson put up his second-highest passing yardage total of the season in a game that was played in significantly inclement winter weather as it unfolded. Wilson was able to get the Steelers within striking distance of a potential game-winning score on the final drive before throwing incomplete on a Hail Mary as time expired. Prior to that, the veteran signal-caller connected with Calvin Austin for a 23-yard touchdown pass with 6:15 remaining, but he'd also lost a fumble at the Steelers' 31-yard line late in the first half that led to a Browns field goal. Wilson's numbers were still encouraging within the context of the weather conditions the game was played in, and he'll now have extra time to prepare for a key divisional Week 13 road clash against the Bengals on Sunday, Dec. 1.

Quiet in Sunday's win

RotoWire Logo Published: 2024-11-17

Wilson completed 23 of 36 passes for 205 yards with an interception in Sunday's 18-16 win over the Ravens.

Both defenses came into the contest with similar ideas and mostly took away the deep passing game, but Wilson also squandered his one chance for a score with a red-zone INT in the fourth quarter. The veteran QB is still 4-0 since taking over the starting job from Justin Fields with a 6:2 TD:INT, and one lackluster performance won't put his job in jeopardy. Wilson will look to bounce back in Week 12 against the Browns.

>>> View all Russell Wilson news